ABIN487184

MFN2 antibody from antibodies-online
CMT2A2, CPRP1, KIAA0214, MARF

Antibody data

Product number
ABIN487184
Provider
antibodies-online
Product name
anti-Mitofusin 2 (MFN2) antibody
Provider product page
antibodies-online - ABIN487184
Antibody type
Polyclonal
Antigen
The immunogen for anti-MFN2 antibody: synthetic peptide directed towards the N terminal of human MFN2
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEA
FLLTE GSEEKRSAKT
Vial size
50 µg
Provider Type Product Number
- No reagents -