ABIN487185

MFN2 antibody from antibodies-online
CMT2A2, CPRP1, KIAA0214, MARF

Antibody data

Product number
ABIN487185
Provider
antibodies-online
Product name
anti-Mitofusin 2 (MFN2) (C-Term) antibody
Provider product page
antibodies-online - ABIN487185
Antibody type
Polyclonal
Antigen
The immunogen for anti-MFN2 antibody: synthetic peptide directed towards the C terminal of human MFN2
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSE
LNMFT HQYLQPSR
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -