PAB29550

SUSD2 antibody from Abnova Corporation
BK65A6.2, FLJ22778, W5C5

Antibody data

Product number
PAB29550
Provider
Abnova Corporation
Product name
SUSD2 polyclonal antibody
Provider product page
Abnova Corporation - PAB29550
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human SUSD2.
Antigen sequence
MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFL
SVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGR
VLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLV
HNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLC
GDDHFCNF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.