HPA004117

SUSD2 antibody from Atlas Antibodies
BK65A6.2, FLJ22778, W5C5

Antibody data

Product number
HPA004117
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004117, RRID:AB_1857674
Product name
Anti-SUSD2
Provider product page
Atlas Antibodies - HPA004117
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFL
SVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGR
VLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLV
HNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLC
GDDHFCNF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.