Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004117 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004117, RRID:AB_1857674
- Product name
- Anti-SUSD2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFL
SVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGR
VLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLV
HNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLC
GDDHFCNF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest.
Isolation and Characterization of Progenitor-Like Cells from Human Renal Proximal Tubules
Pan W, Cheng Y, Zhang H, Liu B, Mo X, Li T, Li L, Cheng X, Zhang L, Ji J, Wang P, Han W
Scientific reports 2014 Oct 29;4:6812
Scientific reports 2014 Oct 29;4:6812
Isolation and Characterization of Progenitor-Like Cells from Human Renal Proximal Tubules
Lindgren D, Boström A, Nilsson K, Hansson J, Sjölund J, Möller C, Jirström K, Nilsson E, Landberg G, Axelson H, Johansson M
The American Journal of Pathology 2011 February;178(2):828-837
The American Journal of Pathology 2011 February;178(2):828-837
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human lung and skeletal muscle tissues using Anti-SUSD2 antibody. Corresponding SUSD2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lung shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN