HPA004117

SUSD2 antibody from Sigma-Aldrich
BK65A6.2, FLJ22778
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004117
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004117, RRID:AB_1857674
Product name
Anti-SUSD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004117
Antibody type
Polyclonal
Antigen
Sushi domain-containing protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFL
SVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGR
VLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLV
HNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLC
GDDHFCNF
Storage
-20C
Provider Type Product Number
- No reagents -