Antibody data

Product number
ABIN1545063
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 330 (ZNF330) (C-Term) antibody
Provider product page
antibodies-online - ABIN1545063
Antibody type
Polyclonal
Antigen
The immunogen for Anti-ZNF330 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNF330
Reactivity
Human
Host
Rabbit
Antigen sequence
DLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSS
DKYGD TSYHDEEEDE
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -