HPA056325

ZNF330 antibody from Atlas Antibodies
HSA6591, NOA36

Antibody data

Product number
HPA056325
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA056325, RRID:AB_2683101
Product name
Anti-ZNF330
Provider product page
Atlas Antibodies - HPA056325
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKKAENRREREKQLRASRSTIDLAKHPCNASMECD
KCQRRQKNRAFCYFCNSVQKLPICAQCGKTKCMMK
SSDCVIKHAGVYSTGLAMVGAICDFCEAWVCHGRK
CLSTHACACPLTDAECVECER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -