PAB20837

ZNF330 antibody from Abnova Corporation
HSA6591, NOA36

Antibody data

Product number
PAB20837
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20837, RRID:AB_10964835
Product name
ZNF330 polyclonal antibody
Provider product page
Abnova Corporation - PAB20837
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF330.
Antigen sequence
SCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHT
RSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSL
KFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYH
D
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -