HPA015705

ZNF330 antibody from Sigma-Aldrich
HSA6591, NOA36
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015705
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015705, RRID:AB_1859199
Product name
Anti-ZNF330 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015705
Antibody type
Polyclonal
Antigen
Zinc finger protein 330 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHT
RSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSL
KFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYH
D
Storage
-20C
Provider Type Product Number
- No reagents -