HPA015705

ZNF330 antibody from Atlas Antibodies
HSA6591, NOA36
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015705
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015705, RRID:AB_1236212
Product name
Anti-ZNF330
Provider product page
Atlas Antibodies - HPA015705
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHT
RSKVFKQEKGKQPPCPKCGHETQETKDLSMSTRSL
KFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYH
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -