Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404889 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and BTB Domain Containing 39 (ZBTB39) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZBTB39 antibody: synthetic peptide directed towards the middle region of human ZBTB39
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CRLCSQSFKSEAAYRYHVSQHKCNSGLDARPGFGL
QHPAL QKRKLPAEEF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 1997 Apr 28;4(2):141-50
DNA research : an international journal for rapid publication of reports on genes and genomes 1997 Apr 28;4(2):141-50
No comments: Submit comment
No validations: Submit validation data