Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA013949 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA013949, RRID:AB_1853599
- Product name
- Anti-MGP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ESMESYELNPFINRRNANTFISPQQRWRAKVQERI
RERSKPVHELNREACDDYRLCERYAMVYGYNAAYN
RYFR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Fetuin, matrix-Gla protein and osteopontin in calcification of renal allografts.
Lorenzen JM, Martino F, Scheffner I, Bröcker V, Leitolf H, Haller H, Gwinner W
PloS one 2012;7(12):e52039
PloS one 2012;7(12):e52039
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissue shows strong cytoplasmic positivity in chondrocytes.
- Sample type
- HUMAN