HPA029192

KLHL4 antibody from MilliporeSigma / Merck KGaA
DKELCHL, KHL4, KIAA1687
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029192
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029192, RRID:AB_10602341
Product name
Anti-KLHL4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029192
Antibody type
Polyclonal
Antigen
kelch-like 4 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLKSHSRDRNGLKKSNSPVHHNILAPVPGPAPAHQ
RAVQNLQQHNLIVHFQANEDTPKSVPEKNLFKEAC
EKRAQDLEMMADDNIEDSTARLDTQHSEDMNATRS
EEQFH
Storage
-20C
Provider Type Product Number
- No reagents -