HPA067448

antibody from Atlas Antibodies

Targeting: ENDOU P11, PP11, PRSS26

Antibody data

Submit

Validation data

Product number: HPA067448 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA067448, RRID:AB_2685843
Product name: Anti-ENDOU
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDY EHLCTEDHKESEPLPQLEEETEEALASNLYSAPTS CQGRCYEAFDKHHQCHCNARCQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ENDOU protein structure - HPA067448 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and skeletal muscle tissues using Anti-ENDOU antibody. Corresponding ENDOU RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human esophagus, lymph node, skeletal muscle and testis using Anti-ENDOU antibody HPA067448 (A) shows similar protein distribution across tissues to independent antibody HPA012388 (B).
Antibody #2 product nr: HPA012388
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ENDOU antibody HPA067448.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ENDOU antibody HPA067448.
Sample type: HUMAN