HPA012388

ENDOU antibody from Sigma-Aldrich
P11, PP11, PRSS26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012388
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012388, RRID:AB_1854860
Product name
Anti-AC004241.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012388
Antibody type
Polyclonal
Antigen
Placental protein 11 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYR
ADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPL
FTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFS
AQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
Storage
-20C
Provider Type Product Number
- No reagents -