Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009275-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009275-M01, RRID:AB_518679
- Product name
- BCL7B monoclonal antibody (M01), clone 6D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BCL7B.
- Antigen sequence
AHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEP
PTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQP
TVPQTASES- Isotype
- IgG
- Antibody clone number
- 6D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B monoclonal antibody (M01), clone 6D2.Lane 1: BCL7B transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BCL7B monoclonal antibody (M01), clone 6D2. Western Blot analysis of BCL7B expression in MCF-7.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BCL7B is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to BCL7B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol