Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00220202-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00220202-D01P, RRID:AB_1673019
- Product name
- ATOH7 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human ATOH7 protein.
- Antigen sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRL
ESAARRRLAANARERRRMQGLNTAFDRLRRVVPQW
GQDKKLSKYETLQMALSYIMALTRILAEAERFGSE
RDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRL
FGFQPEPFQMAT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ATOH7 mutations cause autosomal recessive persistent hyperplasia of the primary vitreous.
A critical analysis of Atoh7 (Math5) mRNA splicing in the developing mouse retina.
Prasov L, Masud T, Khaliq S, Mehdi SQ, Abid A, Oliver ER, Silva ED, Lewanda A, Brodsky MC, Borchert M, Kelberman D, Sowden JC, Dattani MT, Glaser T
Human molecular genetics 2012 Aug 15;21(16):3681-94
Human molecular genetics 2012 Aug 15;21(16):3681-94
A critical analysis of Atoh7 (Math5) mRNA splicing in the developing mouse retina.
Prasov L, Brown NL, Glaser T
PloS one 2010 Aug 24;5(8):e12315
PloS one 2010 Aug 24;5(8):e12315
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ATOH7 expression in transfected 293T cell line (H00220202-T02) by ATOH7 MaxPab polyclonal antibody.Lane 1: ATOH7 transfected lysate(16.90 KDa).Lane 2: Non-transfected lysate.