Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000432 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000432, RRID:AB_1079573
- Product name
- Anti-PCDH11X
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKL
CAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIED
INDNAPLFPATVINISIPENSAINSKYTLPAAVDP
DVGINGVQNYELIKSQNIFGLDVIETPEG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Protocadherin 11X/Y a human-specific gene pair: an immunohistochemical survey of fetal and adult brains.
Genomic profiling of papillary renal cell tumours identifies small regions of DNA alterations: a possible role of HNF1B in tumour development.
Priddle TH, Crow TJ
Cerebral cortex (New York, N.Y. : 1991) 2013 Aug;23(8):1933-41
Cerebral cortex (New York, N.Y. : 1991) 2013 Aug;23(8):1933-41
Genomic profiling of papillary renal cell tumours identifies small regions of DNA alterations: a possible role of HNF1B in tumour development.
Szponar A, Yusenko MV, Kuiper R, van Kessel AG, Kovacs G
Histopathology 2011 May;58(6):934-43
Histopathology 2011 May;58(6):934-43
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human salivary gland shows moderate cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN