HPA000432

PCDH11X antibody from Atlas Antibodies
PCDH-X, PCDH11, PCDHX, PPP1R119
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000432
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000432, RRID:AB_1079573
Product name
Anti-PCDH11X
Provider product page
Atlas Antibodies - HPA000432
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKL
CAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIED
INDNAPLFPATVINISIPENSAINSKYTLPAAVDP
DVGINGVQNYELIKSQNIFGLDVIETPEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -