HPA000432

PCDH11X antibody from Sigma-Aldrich
PCDH-X, PCDH11, PCDHX, PPP1R119
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000432, RRID:AB_1079573
Product name
Anti-PCDH11Y antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000432
Antibody type
Polyclonal
Antigen
Protocadherin-11 Y-linked precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKL
CAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIED
INDNAPLFPATVINISIPENSAINSKYTLPAAVDP
DVGINGVQNYELIKSQNIFGLDVIETPEG
Storage
-20C
Provider Type Product Number
- No reagents -