Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057630-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057630-M01, RRID:AB_607020
- Product name
- SH3MD2 monoclonal antibody (M01), clone 3H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH3MD2.
- Antigen sequence
LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLN
ESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVH
KKREDGWFKGTLQRNGKTGLFPGSFVENI- Isotype
- IgG
- Antibody clone number
- 3H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.
Wilhelm M, Kukekov NV, Schmit TL, Biagas KV, Sproul AA, Gire S, Maes ME, Xu Z, Greene LA
The Journal of biological chemistry 2012 Jan 13;287(3):2247-56
The Journal of biological chemistry 2012 Jan 13;287(3):2247-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SH3MD2 monoclonal antibody (M01), clone 3H3. Western Blot analysis of SH3MD2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SH3MD2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol