H00057630-A01

SH3RF1 antibody from Abnova Corporation
KIAA1494, POSH, RNF142, SH3MD2
No application information provided.

Antibody data

Product number
H00057630-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057630-A01, RRID:AB_463257
Product name
SH3RF1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00057630-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SH3RF1.
Antigen sequence
LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLN
ESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVH
KKREDGWFKGTLQRNGKTGLFPGSFVENI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -