H00054974-A01

THG1L antibody from Abnova Corporation
FLJ11601, FLJ20546, hTHG1, ICF45, IHG-1
No application information provided.

Antibody data

Product number
H00054974-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054974-A01, RRID:AB_1139209
Product name
ICF45 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00054974-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant ICF45.
Antigen sequence
MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHR
FAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVI
AYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFA
SSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTL
KDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQA
QGRLQGTLAADKNEILFSEFNINYNNELPMYRKGT
VLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKP
VPLHCDIIGDAFWKEHPEILDEDS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -