H00054974-B01P

THG1L antibody from Abnova Corporation
FLJ11601, FLJ20546, hTHG1, ICF45, IHG-1

Antibody data

Product number
H00054974-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054974-B01P, RRID:AB_1576144
Product name
ICF45 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00054974-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ICF45 protein.
Antigen sequence
MWGACKVKVHDSLATISITLRRYLRLGATMAKSKF
EYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHN
FAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSD
EYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFY
WRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSW
RQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQG
TLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQK
VDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCD
IIGDAFWKEHPEILDEDS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -