Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502899 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-tRNA-Histidine Guanylyltransferase 1-Like (S. Cerevisiae) (THG1L) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-THG1L antibody: synthetic peptide directed towards the middle region of human THG1L
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLA
ADKNE ILFSEFNINY- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of a novel cytoplasm protein ICF45 that is involved in cell cycle regulation.
Guo D, Hu K, Lei Y, Wang Y, Ma T, He D
The Journal of biological chemistry 2004 Dec 17;279(51):53498-505
The Journal of biological chemistry 2004 Dec 17;279(51):53498-505
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting