Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91134 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91134, RRID:AB_2665814
- Product name
- Anti-LAMA4
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
ENLLNQARELQAKAESSSDEAVADTSRRVGGALAR
KSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITE
EANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAY
NTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPAS- Epitope
- Binds to an epitope located within the peptide sequence GALARKSALKTRLSD as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3185
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-411, Laminin-421, Laminin-511, Laminin-121, Laminin-221 and Laminin-332.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong positivity in basement membrane of trophoblast and in endothelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate membranous positivity in smooth muscle cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of immunoreactivity in lymphoid tissue (negative control).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse heart muscle shows membranous positivity in cardiomyocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse stomach shows strong positivity in basement membrane of glandular epithelium and in smooth muscle layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse epididymis shows immunoreactivity in smooth muscle in the lamina propria.