Antibody data

Product number
H00009685-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009685-M03, RRID:AB_1137190
Product name
ENTH monoclonal antibody (M03), clone 1E6
Provider product page
Abnova Corporation - H00009685-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ENTH.
Antigen sequence
GVSSDSVGGFRYSERYDPEPKSKWDEEWDKNKSAF
PFSDKLGELSDKIGSTIDDTISKFRRKDREDSPER
CSDSDEEKKARRGRSPKGEFKDEEETVTTKH
Isotype
IgG
Antibody clone number
1E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -