HPA035531

PPM1G antibody from MilliporeSigma / Merck KGaA
PP2CG, PP2Cgamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035531
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035531, RRID:AB_10610283
Product name
Anti-PPM1G antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035531
Antibody type
Polyclonal
Antigen
protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma-isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDA
KLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD
Storage
-20C
Provider Type Product Number
- No reagents -