Antibody data

Product number
ABIN404910
Provider
antibodies-online
Product name
anti-Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1) antibody
Provider product page
antibodies-online - ABIN404910
Antibody type
Polyclonal
Antigen
The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTG
TRSEK NHFESSPLPT
Vial size
50 µg
Provider Type Product Number
- No reagents -