HPA025692

ADCK5 antibody from Sigma-Aldrich
FLJ35454
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025692
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025692, RRID:AB_10599486
Product name
Anti-ADCK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025692
Antibody type
Polyclonal
Antigen
aarF domain containing kinase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGVEENSPGYLEVMSACHQRAADALVAGAISNGGL
YVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGF
QEVDELFLEDFQALPHELFQEFD
Storage
-20C
Provider Type Product Number
- No reagents -