Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183185 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chloride Channel 3 (CLCN3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLCN3 antibody: synthetic peptide is 86% homologous to the C terminal of human CLCN3.
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLA
ADVMR PRRNDPPLAVL- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A quantitative assay for lysosomal acidification rates in human osteoclasts.
AP-3-dependent mechanisms control the targeting of a chloride channel (ClC-3) in neuronal and non-neuronal cells.
Jensen VK, Nosjean O, Dziegiel MH, Boutin JA, Sørensen MG, Karsdal MA, Henriksen K
Assay and drug development technologies 2011 Apr;9(2):157-64
Assay and drug development technologies 2011 Apr;9(2):157-64
AP-3-dependent mechanisms control the targeting of a chloride channel (ClC-3) in neuronal and non-neuronal cells.
Salazar G, Love R, Styers ML, Werner E, Peden A, Rodriguez S, Gearing M, Wainer BH, Faundez V
The Journal of biological chemistry 2004 Jun 11;279(24):25430-9
The Journal of biological chemistry 2004 Jun 11;279(24):25430-9
No comments: Submit comment
No validations: Submit validation data