HPA015849

SORBS3 antibody from Sigma-Aldrich
SCAM-1, SH3D4, vinexin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015849
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015849, RRID:AB_1857365
Product name
Anti-SORBS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015849
Antibody type
Polyclonal
Antigen
Vinexin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPASAWSSSYPHAPYLGSARSLSPHKMADGGSPFL
GRRDFVYPSSTRDPSASNGGGSPARREEKKRKAAR
LKFDFQAQSPKELTLQKGDIVYIHKEVDKNWL
Storage
-20C
Provider Type Product Number
- No reagents -