H00114049-M11
antibody from Abnova Corporation
Targeting: BUD23
MERM1, MGC19709, MGC2022, MGC5140, PP3381, WBMT, WBSCR22
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114049-M11 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114049-M11, RRID:AB_1717059
- Product name
- WBSCR22 monoclonal antibody (M11), clone 2E12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WBSCR22.
- Antigen sequence
MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDI
QTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSY
LSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDM
GQGIP- Isotype
- IgG
- Antibody clone number
- 2E12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged WBSCR22 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to WBSCR22 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of WBSCR22 transfected lysate using anti-WBSCR22 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with WBSCR22 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol