H00002687-M01A

GGT5 antibody from Abnova Corporation
GGT-REL, GGTLA1
No application information provided.

Antibody data

Product number
H00002687-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002687-M01A, RRID:AB_1575184
Product name
GGTLA1 monoclonal antibody (M01A), clone 3E10
Provider product page
Abnova Corporation - H00002687-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GGTLA1.
Antigen sequence
GFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGL
QDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRK
SGEAAGY
Isotype
IgM
Antibody clone number
3E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -