HPA008121

GGT5 antibody from Sigma-Aldrich
GGT-REL, GGTLA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008121
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008121, RRID:AB_1078965
Product name
Anti-GGTLA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008121
Antibody type
Polyclonal
Antigen
gamma-Glutamyltransferase 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTG
IILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPG
RCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAG
GELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNS
KG
Storage
-20C
Provider Type Product Number
- No reagents -