HPA015592

TBC1D15 antibody from Sigma-Aldrich
DKFZp761D0223, FLJ12085
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015592
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015592, RRID:AB_1857789
Product name
Anti-TBC1D15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015592
Antibody type
Polyclonal
Antigen
TBC1 domain family member 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRVLEKDAEVIVDWRPLDDALDSSSILYARKDSSS
VVEWTQAPKERGHRGSEHLNSYEAEWDMVNTVSFK
RKPHTNGDAPSHRNGKSKWSFLFSLTDLKSIKQNK
EGMGWSYLVFCLKDDVVLPALHF
Storage
-20C
Provider Type Product Number
- No reagents -