HPA013388

TBC1D15 antibody from Atlas Antibodies
DKFZp761D0223, FLJ12085
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013388
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013388, RRID:AB_1670005
Product name
Anti-TBC1D15
Provider product page
Atlas Antibodies - HPA013388
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSKLLIESLEKYVVLCESPQDKRTLLVNCQNKSLS
QSFENLLDEPAYGLIQKIKKDPYTATMIGFSKVTN
YIFDSLRGSDPSTHQRPPSEMADFLSDAIPGLKIN
QQEEPGFEVITRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -