HPA013388

TBC1D15 antibody from Atlas Antibodies
DKFZp761D0223, FLJ12085
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013388
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013388, RRID:AB_2199233
Product name
Anti-TBC1D15
Provider product page
Atlas Antibodies - HPA013388
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSKLLIESLEKYVVLCESPQDKRTLLVNCQNKSLS
QSFENLLDEPAYGLIQKIKKDPYTATMIGFSKVTN
YIFDSLRGSDPSTHQRPPSEMADFLSDAIPGLKIN
QQEEPGFEVITRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -