HPA015592

TBC1D15 antibody from Atlas Antibodies
DKFZp761D0223, FLJ12085
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015592
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015592, RRID:AB_1235838
Product name
Anti-TBC1D15
Provider product page
Atlas Antibodies - HPA015592
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRVLEKDAEVIVDWRPLDDALDSSSILYARKDSSS
VVEWTQAPKERGHRGSEHLNSYEAEWDMVNTVSFK
RKPHTNGDAPSHRNGKSKWSFLFSLTDLKSIKQNK
EGMGWSYLVFCLKDDVVLPALHF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -