HPA012023

CES1 antibody from Sigma-Aldrich
CEH, CES1A1, CES1A2, CES2, HMSE, HMSE1, SES1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012023
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012023, RRID:AB_1846554
Product name
Anti-CES1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012023
Antibody type
Polyclonal
Antigen
Liver carboxylesterase 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGV
ALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVH
CLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLL
GTVIDGMLLLKTPEELQAERNFHTVP
Storage
-20C
Provider Type Product Number
- No reagents -