HPA012023

antibody from Atlas Antibodies

Targeting: CES1 CEH, CES1A1, CES1A2, CES2, HMSE, HMSE1, SES1

Antibody data

Submit

Validation data

Product number: HPA012023 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012023, RRID:AB_1846554
Product name: Anti-CES1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGV ALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVH CLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLL GTVIDGMLLLKTPEELQAERNFHTVP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CES1 protein structure - HPA012023 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and kidney tissues using Anti-CES1 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-CES1 antibody HPA012023 (A) shows similar protein distribution across tissues to independent antibody HPA046717 (B).
Antibody #2 product nr: HPA046717
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CES1 antibody HPA012023.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CES1 antibody HPA012023.
Sample type: HUMAN