Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009825-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009825-M01, RRID:AB_530206
- Product name
- SPATA2 monoclonal antibody (M01), clone 1F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SPATA2.
- Antigen sequence
SLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTP
TSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYDP
CYKKSELHKFMPNNQLNYKSTQLSHLVY- Isotype
- IgG
- Antibody clone number
- 1F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Upregulated hPuf-A promotes breast cancer tumorigenesis.
Fan CC, Lee LY, Yu MY, Tzen CY, Chou C, Chang MS
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2013 Oct;34(5):2557-64
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2013 Oct;34(5):2557-64
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SPATA2 monoclonal antibody (M01), clone 1F1 Western Blot analysis of SPATA2 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SPATA2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SPATA2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol