Antibody data

Product number
ABIN311116
Provider
antibodies-online
Product name
anti-PWWP Domain Containing 2A (PWWP2A) (C-Term) antibody
Provider product page
antibodies-online - ABIN311116
Antibody type
Polyclonal
Antigen
The immunogen for anti-PWWP2A antibody: synthetic peptide directed towards the C terminal of human PWWP2A
Description
Affinity Purified
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTD
HCGFR LGALKLTVKR
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.