AV48981

PWWP2A antibody from MilliporeSigma / Merck KGaA
KIAA1935
No application information provided.

Antibody data

Product number
AV48981
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-PWWP2A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV48981
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PWWP2A with an internal ID of Y02126
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKPQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCL
TDHCGFRLGALKLTV
Storage
-20C