Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001475 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001475, RRID:AB_1080172
- Product name
- Anti-SYTL4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GKSALEAESESLDSFTADSDSTSRRDSLDKSGLFP
EWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKK
NTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSK
SVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQ
SGSSM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Neurexin-1 Contributes to Insulin-containing Secretory Granule Docking
Hermansky-Pudlak syndrome protein complexes associate with phosphatidylinositol 4-kinase type II alpha in neuronal and non-neuronal cells.
Mosedale M, Egodage S, Calma R, Chi N, Chessler S
Journal of Biological Chemistry 2012 February;287(9):6350-6361
Journal of Biological Chemistry 2012 February;287(9):6350-6361
Hermansky-Pudlak syndrome protein complexes associate with phosphatidylinositol 4-kinase type II alpha in neuronal and non-neuronal cells.
Salazar G, Zlatic S, Craige B, Peden AA, Pohl J, Faundez V
The Journal of biological chemistry 2009 Jan 16;284(3):1790-802
The Journal of biological chemistry 2009 Jan 16;284(3):1790-802
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and SYTL4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409049).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & microtubule organizing center.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN