HPA001475

SYTL4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001475
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001475, RRID:AB_1080172
Product name
Anti-SYTL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001475
Antibody type
Polyclonal
Antigen
Synaptotagmin-like protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKSALEAESESLDSFTADSDSTSRRDSLDKSGLFP
EWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKK
NTRKILRPSEYTKSVIDLRPEDVVHESGSLGDRSK
SVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQ
SGSSM
Storage
-20C
Provider Type Product Number
- No reagents -