HPA001589

SYTL4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001589
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001589, RRID:AB_1080174
Product name
Anti-SYTL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001589
Antibody type
Polyclonal
Antigen
Synaptotagmin-like protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGR
LSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAK
EIELKKATGDWFYDQKVNRFAYRTGSEIIRMSLRH
KPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQK
EPSVLFEVP
Storage
-20C
Provider Type Product Number
- No reagents -