HPA013376

PARD6B antibody from Sigma-Aldrich
PAR-6B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013376
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013376, RRID:AB_1854972
Product name
Anti-PARD6B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013376
Antibody type
Polyclonal
Antigen
Partitioning defective 6 homolog beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIK
KKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSII
DVDILPETHRRV
Storage
-20C
Provider Type Product Number
- No reagents -