HPA030656

PPP6R2 antibody from MilliporeSigma / Merck KGaA
dJ579N16.1, KIAA0685, SAP190, SAPS2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030656
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030656, RRID:AB_10602926
Product name
Anti-SAPS2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030656
Antibody type
Polyclonal
Antigen
SAPS domain family, member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQ
ECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDME
EKVRFKYPNTACELLTCDVPQISDRLGGDESLLSL
LYDFLDHEPPLNPLLASFFS
Storage
-20C
Provider Type Product Number
- No reagents -