HPA015648

GDF5 antibody from Sigma-Aldrich
BMP14, CDMP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015648
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015648, RRID:AB_1849589
Product name
Anti-GDF5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015648
Antibody type
Polyclonal
Antigen
Growth/differentiation factor 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYVFDISALEKDGLLGAELRILRKKPSDTAKPAAP
GGGRAAQLKLSSCPSGRQPASLLDVRSVPGLDGSG
WEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDL
Storage
-20C
Provider Type Product Number
- No reagents -