HPA028396

C1orf158 antibody from MilliporeSigma / Merck KGaA
MGC35194
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028396
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028396, RRID:AB_10603451
Product name
Anti-C1orf158 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028396
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf158 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTR
DTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVE
GLPYKHLITHHQ
Storage
-20C
Provider Type Product Number
- No reagents -