HPA015593

NSRP1 antibody from Sigma-Aldrich
CCDC55, DKFZP434K1421, NSrp70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015593
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015593, RRID:AB_2072217
Product name
Anti-CCDC55 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015593
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 55 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSN
KMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQE
KGKEQERPPEAVSKFAKRNNEETVM
Storage
-20C
Provider Type Product Number
- No reagents -